PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00835.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 656aa    MW: 72889.8 Da    PI: 6.5938
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00835.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.61.7e-21124224199
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d+++++W +++i+r++++r++lt+GW+ Fv++++L +gD 
  Rsa1.0_00835.1_g00016.1 124 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHNNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDA 207
                              99****************************964333..4459******************************************** PP

                              EEEEE-SSSEE..EEEEE-S CS
                       B3  80 vvFkldgrsefelvvkvfrk 99 
                              ++F    r+++el+v+v+r+
  Rsa1.0_00835.1_g00016.1 208 FIFL---RQNEELRVGVRRH 224
                              ****...577889****996 PP

2Auxin_resp112.44.3e-37249331183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aaha++t+++F+v+Y+Pr+s+seF+v+v+++++a ++k++vGmRfkm+fe+e+++e+r+sGt+vgv++ +++ W++S+WrsLk
  Rsa1.0_00835.1_g00016.1 249 AAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLAVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLK 331
                              79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.67E-43113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-38121238IPR015300DNA-binding pseudobarrel domain
CDDcd100172.16E-18122223No hitNo description
SMARTSM010199.7E-19124225IPR003340B3 DNA binding domain
PROSITE profilePS5086310.207124225IPR003340B3 DNA binding domain
PfamPF023622.6E-19124224IPR003340B3 DNA binding domain
PfamPF065072.9E-34249331IPR010525Auxin response factor
PfamPF023096.9E-12493623IPR033389AUX/IAA domain
PROSITE profilePS5174529.994533626IPR000270PB1 domain
SuperFamilySSF542771.83E-11535610No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MAASNHPSGK PGGALSDALC RELWHACAGP LVTLPREGER VYYFPEGHME QLEASMHQGS  60
EQKMPSFNLP SKILCKVINI QRRAEPETDE VYAQITLLPE ADQSEPMSPD APVQEPEKCT  120
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH NNEWHFRHIF  180
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRQNEELRVG VRRHMRQQTN IPSSVISSHS  240
MHIGVLATAA HAITTGTIFS VFYKPRTSRS EFIVSVNRYL EAKNQKLAVG MRFKMRFEGE  300
EAPEKRFSGT IVGVQENKSS VWHDSEWRSL KVQWDEPSSV FRPERVSPWE LEPLVANNTP  360
SAHLPPQRNK RPRPPGLPSP TTAPSTPDGV WKSPADNPSS VPLFSPPAKT AAFGHGGNKS  420
FGVSIGSAFW PTHADGAAES FASALNNESP TTEKKQTSGN VCRLFGFELV ENMNVDECFS  480
AASVSGAVAV DQPPSNEFDS SQQSESLNIN QASGDPEKSS LRSPQESQSR QIRSCTKVHM  540
QGSAVGRAVD LTRSECYEDL FKKLEEMFDI KGELLQSTKK WQVVYTDDED DMMMVGDDPW  600
NEFCGMVRKI FIYTPEEVKK LSPKNKLTVN VRMQSKTDAD ENGNAEGRSS SMAGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013541355Auxin response factor 1
4ldw_A0.013541355Auxin response factor 1
4ldw_B0.013541355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1369373KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794580.0JN979458.1 Brassica rapa subsp. pekinensis auxin response factor 1 (ARF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103143.10.0PREDICTED: auxin response factor 1 isoform X2
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A078JF090.0A0A078JF09_BRANA; Auxin response factor
STRINGBra035427.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.20.0auxin response factor 1